PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna18756.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 387aa    MW: 42508.7 Da    PI: 7.7416
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna18756.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.65.8e-184388147
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                             rg W++eEd +l ++v ++G ++W++Iar ++ gR++k+c++rw++ 
  mrna18756.1-v1.0-hybrid 43 RGVWSQEEDRILSRLVSKFGARNWTLIARGIP-GRCGKSCRLRWFNQ 88
                             899*****************************.***********996 PP

2Myb_DNA-binding54.52.7e-1795139147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              r+++++eEd  ++ a++ +G++ W++Ia+ ++ gRt++ +k++w++ 
  mrna18756.1-v1.0-hybrid  95 RKPFSAEEDRMIISAHAIHGNK-WSAIAKLLP-GRTDNAIKNHWNST 139
                              789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.7183889IPR017930Myb domain
SuperFamilySSF466897.91E-3141136IPR009057Homeodomain-like
SMARTSM007173.5E-154291IPR001005SANT/Myb domain
PfamPF002496.7E-174388IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-244596IPR009057Homeodomain-like
CDDcd001672.67E-144687No hitNo description
PROSITE profilePS5129426.21190144IPR017930Myb domain
SMARTSM007174.5E-1794142IPR001005SANT/Myb domain
PfamPF002491.6E-1595139IPR001005SANT/Myb domain
CDDcd001678.12E-1397140No hitNo description
Gene3DG3DSA:1.10.10.607.5E-2497142IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MEPELAEDTA AVIGIEASED DAGSGKDAAA KGEKGKKRKS RVRGVWSQEE DRILSRLVSK  60
FGARNWTLIA RGIPGRCGKS CRLRWFNQLD PILKRKPFSA EEDRMIISAH AIHGNKWSAI  120
AKLLPGRTDN AIKNHWNSTL RRRDPNRLMS ELGIEDVSLD KRKASSEETL SNGDVNSSRS  180
TEGKEVCSLE YTDDQHEDKV STDGQYSNEA REPRTLFRPV AHVSAFSVYN HLGGQDPSSS  240
FQKPIPVQGP LVQEVKLDVG ICKLVEGIYG EQSVPDQCGH GCCCTQNGRT TGNSLLGPEF  300
VEFSEPPCFP SFEMAAIATD ISKLAWLKSG LESSSGMVTS DAAASRLSHG SQGQFGHSEE  360
SRMNRLLRQE KRKDRLMGMK TNVLST*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-37421436107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00337DAPTransfer from AT3G09230Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFR8285580.0FR828558.1 Rosa hybrid cultivar mRNA for putative MYB transcription factor (myb7 gene), cultivar Yellow Island.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004302679.10.0PREDICTED: transcription factor LAF1
TrEMBLM5VYL21e-178M5VYL2_PRUPE; Uncharacterized protein
STRINGVIT_08s0007g01540.t011e-157(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39863362
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09230.13e-96myb domain protein 1